PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0152s0043.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 476aa    MW: 51547.6 Da    PI: 7.1786
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0152s0043.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.74.9e-33208264259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          dDgynWrKYGqK+vkgs +prsYY+Ct a Cpvkkkvers  d++v+ei+Y+g+Hnh+
  Kalax.0152s0043.1.p 208 DDGYNWRKYGQKQVKGSAYPRSYYKCTNAACPVKKKVERSL-DGQVTEIIYKGQHNHK 264
                          8****************************************.***************7 PP

2WRKY106.51.3e-33362420159
                          ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          ldDgy+WrKYGqK+vkg+++prsYY+Ct+++C+v+k+ver+a+dp++v++tYeg+Hnh+
  Kalax.0152s0043.1.p 362 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPECKVRKHVERAATDPRAVITTYEGKHNHD 420
                          59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.9E-29201266IPR003657WRKY domain
PROSITE profilePS5081124.306202266IPR003657WRKY domain
SuperFamilySSF1182901.44E-25204266IPR003657WRKY domain
SMARTSM007745.4E-36207265IPR003657WRKY domain
PfamPF031064.0E-25208264IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.7E-37348422IPR003657WRKY domain
SuperFamilySSF1182902.22E-29354422IPR003657WRKY domain
PROSITE profilePS5081137.367357422IPR003657WRKY domain
SMARTSM007742.1E-38362421IPR003657WRKY domain
PfamPF031068.1E-26363420IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MAAERKNGSN ENHFPTQPQQ GINGPRPTLS LPPRSSAESM FLTSAGFSPG PMTLVSSFFS  60
ETDPSSEFRS FSQLLAGGFD SQDVKIDGGG GGSGNGFEFK QSQPSHLPPG LTVSRPQLFT  120
IPPGLSPSTL LDSPTIFGYN QNGFGMAAGS SQPQQQMQHQ LNMDYPAPMA RFPTGMAAAP  180
VVDRQGLIGS SSDYTHNEMC AVADKPADDG YNWRKYGQKQ VKGSAYPRSY YKCTNAACPV  240
KKKVERSLDG QVTEIIYKGQ HNHKPPPASK RSREAGGIGL EAGLYAEATN LEGGSVSRNN  300
EHDSSDSEDV GDGDAGADEV DEDEPEAKRR ITEARASEAS ASHRTLTEPK IVVQTTSEVD  360
LLDDGYRWRK YGQKVVKGNP YPRSYYKCTT PECKVRKHVE RAATDPRAVI TTYEGKHNHD  420
VPAAKSSSHN TARPQEPQQN GSAGNHQASS NRTDYQNSSR QRPGAFPRLK EEQTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-42208423878Probable WRKY transcription factor 4
2lex_A1e-42208423878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010258724.11e-152PREDICTED: probable WRKY transcription factor 4
SwissprotQ9XI901e-142WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A068TVV41e-152A0A068TVV4_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000728361e-142(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-109WRKY DNA-binding protein 3